PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01234.1.p
Common NameLOC105967534, MIMGU_mgv1a004979mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 503aa    MW: 55232.9 Da    PI: 8.2419
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01234.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.85.2e-34229285259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       dDgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d +++ei+Y+g+Hnh+
  Migut.L01234.1.p 229 DDGYNWRKYGQKQVKGSEYPRSYYKCTHPKCPVKKKVERSL-DAQITEIIYKGQHNHP 285
                       8****************************************.***************8 PP

2WRKY107.18.9e-34383441159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+a+dpk+v++tYeg+Hnh+
  Migut.L01234.1.p 383 LDDGYRWRKYGQKVVKGNPYPRSYYKCTSQGCNVRKHVERAATDPKAVITTYEGKHNHD 441
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.2E-31222287IPR003657WRKY domain
SuperFamilySSF1182901.83E-26226287IPR003657WRKY domain
SMARTSM007744.9E-38228286IPR003657WRKY domain
PfamPF031064.5E-26229285IPR003657WRKY domain
PROSITE profilePS5081124.202229287IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-37368443IPR003657WRKY domain
SuperFamilySSF1182907.45E-30375443IPR003657WRKY domain
PROSITE profilePS5081139.157378443IPR003657WRKY domain
SMARTSM007745.7E-40383442IPR003657WRKY domain
PfamPF031062.6E-26384441IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MAENEFQPPR RPQPTSRPPA PTITLPPRSA VDSLFMGVGA AAGVSPGPMS LVSSFFAEND  60
DPDNDCRSFS QLLAGAISSP PSAANVRHNF GQPAAENRGG DGGSGEFRFQ QNRPAGLMVS  120
QQHGMFTIPA GLSPASLLDS PVFFPSSQGA MGTSHQHFLA QLTAQAQMNI HSSYPSSSSA  180
SLPPHYSNAT LQINSLPGRN IVKESSDISN SDQKLQLAAP NLVVDKPADD GYNWRKYGQK  240
QVKGSEYPRS YYKCTHPKCP VKKKVERSLD AQITEIIYKG QHNHPPPAKR TKDYPDGGIN  300
HHGNSELDSR TTNEGIKDQE SSQFTHERVT GSSDSDEVNG SHEDEPESKR RNIEVQTTEQ  360
ASSHRTVTEP RIIVQTTSEV DLLDDGYRWR KYGQKVVKGN PYPRSYYKCT SQGCNVRKHV  420
ERAATDPKAV ITTYEGKHNH DVPAAKNSSH STANNAAASS SSQSRPQNAS FDRQMENRRI  480
EFRSNEMQHP VSLLRFKEEH IT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-43229444878Probable WRKY transcription factor 4
2lex_A9e-43229444878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847588.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-152WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A022QQN50.0A0A022QQN5_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000728360.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41072445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-135WRKY DNA-binding protein 4